RFC4 monoclonal antibody (M01), clone 1C12

Catalog # H00005984-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RFC4 monoclonal antibody (M01), clone 1C12 Western Blot analysis of RFC4 expression in K-562 ( Cat # L009V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 monoclonal antibody (M01), clone 1C12.

Lane 1: RFC4 transfected lysate(39.7 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to RFC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of RFC4 over-expressed 293 cell line, cotransfected with RFC4 Validated Chimera RNAi ( Cat # H00005984-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RFC4 monoclonal antibody (M01), clone 1C12 (Cat # H00005984-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (37.73 KDa) .

  • Specifications

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant RFC4.

    Immunogen

    RFC4 (AAH17452, 254 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.73 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    RFC4 monoclonal antibody (M01), clone 1C12 Western Blot analysis of RFC4 expression in K-562 ( Cat # L009V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 monoclonal antibody (M01), clone 1C12.

    Lane 1: RFC4 transfected lysate(39.7 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to RFC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of RFC4 over-expressed 293 cell line, cotransfected with RFC4 Validated Chimera RNAi ( Cat # H00005984-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RFC4 monoclonal antibody (M01), clone 1C12 (Cat # H00005984-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — RFC4

    Entrez GeneID

    5984

    GeneBank Accession#

    BC017452

    Protein Accession#

    AAH17452

    Gene Name

    RFC4

    Gene Alias

    A1, MGC27291, RFC37

    Gene Description

    replication factor C (activator 1) 4, 37kDa

    Omim ID

    102577

    Gene Ontology

    Hyperlink

    Gene Summary

    The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq

    Other Designations

    A1 37 kDa subunit|RFC 37 kDa subunit|activator 1 37 kDa subunit|replication factor C (activator 1) 4 (37kD)|replication factor C 4

  • Interactomes
  • Pathways
  • Diseases
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All