Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RFC1 polyclonal antibody (A01)

  • Catalog # : H00005981-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RFC1.
  • Immunogen:
  • RFC1 (AAH51786, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005981-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5981
  • Gene Name:
  • RFC1
  • Gene Alias:
  • A1,MGC51786,MHCBFB,PO-GA,RECC1,RFC,RFC140
  • Gene Description:
  • replication factor C (activator 1) 1, 145kDa
  • Gene Summary:
  • The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq
  • Other Designations:
  • MHC binding factor, beta,replication factor C (activator 1) 1 (145kD),replication factor C large subunit,replication factor C1
  • RSS
  • YouTube
  • Linkedin
  • Facebook