DPF2 monoclonal antibody (M01), clone 2F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DPF2 monoclonal antibody (M01), clone 2F6 Western Blot analysis of DPF2 expression in LNCaP ( Cat # L004V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of DPF2 expression in transfected 293T cell line by DPF2 monoclonal antibody (M01), clone 2F6.
Lane 1: DPF2 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to DPF2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DPF2.
Immunogen
DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK
Host
Mouse
Reactivity
Human
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DPF2 monoclonal antibody (M01), clone 2F6 Western Blot analysis of DPF2 expression in LNCaP ( Cat # L004V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DPF2 expression in transfected 293T cell line by DPF2 monoclonal antibody (M01), clone 2F6.
Lane 1: DPF2 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DPF2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DPF2
Entrez GeneID
5977GeneBank Accession#
BC014889Protein Accession#
AAH14889Gene Name
DPF2
Gene Alias
MGC10180, REQ, UBID4, ubi-d4
Gene Description
D4, zinc and double PHD fingers family 2
Omim ID
601671Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq
Other Designations
apoptosis response zinc finger protein|requiem, apoptosis response zinc finger
-
Interactome
-
Publication Reference
-
Transient and etiology-related transcription regulation in cirrhosis prior to hepatocellular carcinoma occurrence.
Caillot F, Derambure C, Bioulac-Sage P, Francois A, Scotte M, Goria O, Hiron M, Daveau M, Salier JP.
World Journal of Gastroenterology 2009 Jan; 15(3):300.
Application：IHC-P, Human, Human liver cancer.
-
Transient and etiology-related transcription regulation in cirrhosis prior to hepatocellular carcinoma occurrence.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com