DPF2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DPF2.
Immunogen
DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag.
Sequence
WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — DPF2
Entrez GeneID
5977GeneBank Accession#
BC014889Protein Accession#
AAH14889Gene Name
DPF2
Gene Alias
MGC10180, REQ, UBID4, ubi-d4
Gene Description
D4, zinc and double PHD fingers family 2
Omim ID
601671Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq
Other Designations
apoptosis response zinc finger protein|requiem, apoptosis response zinc finger
-
Interactome
-
Publication Reference
-
Double PHD fingers protein DPF2 recognizes acetylated histones and suppresses the function of ERR{alpha} through histone deacetylase 1.
Matsuyama R, Takada I, Yokoyama A, Fujiyma-Nakamura S, Tsuji N, Kitagawa H, Fujiki R, Kim M, Kouzu-Fujita M, Yano T, Kato S.
The Journal of Biological Chemistry 2010 Jun; 285(24):18166.
Application：IP, WB-Ce, WB-Tr, Mouse, C2C12 cells.
-
Double PHD fingers protein DPF2 recognizes acetylated histones and suppresses the function of ERR{alpha} through histone deacetylase 1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com