Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RENT1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005976-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RENT1 partial ORF ( NP_002902.2, 1019 a.a. - 1116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005976-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5976
  • Gene Name:
  • UPF1
  • Gene Alias:
  • FLJ43809,FLJ46894,HUPF1,KIAA0221,NORF1,RENT1,pNORF1
  • Gene Description:
  • UPF1 regulator of nonsense transcripts homolog (yeast)
  • Gene Summary:
  • This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq
  • Other Designations:
  • UP Frameshift 1,delta helicase,nonsense mRNA reducing factor 1,regulator of nonsense transcripts 1,up-frameshift mutation 1 homolog,yeast Upf1p homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook