UPF1 monoclonal antibody (M01), clone 4G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UPF1.
Immunogen
UPF1 (NP_002902.2, 1019 a.a. ~ 1116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UPF1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — UPF1
Entrez GeneID
5976GeneBank Accession#
NM_002911Protein Accession#
NP_002902.2Gene Name
UPF1
Gene Alias
FLJ43809, FLJ46894, HUPF1, KIAA0221, NORF1, RENT1, pNORF1
Gene Description
UPF1 regulator of nonsense transcripts homolog (yeast)
Omim ID
601430Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq
Other Designations
UP Frameshift 1|delta helicase|nonsense mRNA reducing factor 1|regulator of nonsense transcripts 1|up-frameshift mutation 1 homolog|yeast Upf1p homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com