REN monoclonal antibody (M01), clone 2H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant REN.
Immunogen
REN (AAH47752, 24 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (66)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (67.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
REN monoclonal antibody (M01), clone 2H2. Western Blot analysis of REN expression in HeLa.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged REN is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — REN
Entrez GeneID
5972GeneBank Accession#
BC047752Protein Accession#
AAH47752Gene Name
REN
Gene Alias
FLJ10761
Gene Description
renin
Gene Ontology
HyperlinkGene Summary
Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause familial hyperproreninemia. [provided by RefSeq
Other Designations
OTTHUMP00000034311|angiotensin-forming enzyme|angiotensinogenase|renin precursor, renal
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
ER ribosomal-binding protein 1 regulates blood pressure and potassium homeostasis by modulating intracellular renin trafficking.
Chu-Hsuan Chiu, Chin-Feng Hsuan, Shih-Hua Lin, Yi-Jen Hung, Chii-Min Hwu, Siow-Wey Hee,Shu-Wha Lin, Sitt-Wai Fong, Patrick Ching-Ho Hsieh, Wei-Shun Yang, Wei-Chou Lin, Hsiao-Lin Lee, Meng-Lun Hsieh, Wen-Yi Li, Jou-Wei Lin, Chih-Neng Hsu, Vin-Cent Wu, Gwo-Tsann Chuang, Yi-Cheng Chang and Lee-Ming Chuang.
Journal of Biomedical Science 2023 Feb; 30:13.
Application:WB-Ti, WB-Tr, IF-Tr, IHC-P, Immuno-electron microscopy, Human, Mouse, Calu-6 cells, Mouse kidney and adrenal glands.
-
HIV-induced kidney cell injury: role of ROS-induced downregulated vitamin D receptor.
Salhan D, Husain M, Subrati A, Goyal R, Singh T, Rai P, Malhotra A, Singhal PC.
American Journal of Physiology. Renal Physiology 2012 Aug; 303(4):F503.
Application:WB-Tr, Mouse, Mouse proximal tubular epithelial cells MC, Renal tissues.
-
ER ribosomal-binding protein 1 regulates blood pressure and potassium homeostasis by modulating intracellular renin trafficking.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com