Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

REG1A (Human) Recombinant Protein (P02)

  • Catalog # : H00005967-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human REG1A full-length ORF (NP_002900.2, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00005967-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5967
  • Gene Name:
  • REG1A
  • Gene Alias:
  • ICRF,MGC12447,P19,PSP,PSPS,PSPS1,PTP,REG
  • Gene Description:
  • regenerating islet-derived 1 alpha
  • Gene Summary:
  • This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160485,islet cells regeneration factor,islet of langerhans regenerating protein,lithostathine 1 alpha,pancreatic stone protein, secretory,pancreatic thread protein,protein-X,regenerating islet-derived 1 alpha (pancreatic stone protein, pancrea
  • RSS
  • YouTube
  • Linkedin
  • Facebook