Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

REG1A purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00005967-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human REG1A protein.
  • Immunogen:
  • REG1A (NP_002900.2, 1 a.a. ~ 166 a.a) full-length human protein.
  • Sequence:
  • MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Entrez GeneID:
  • 5967
  • Gene Name:
  • REG1A
  • Gene Alias:
  • ICRF,MGC12447,P19,PSP,PSPS,PSPS1,PTP,REG
  • Gene Description:
  • regenerating islet-derived 1 alpha
  • Gene Summary:
  • This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160485,islet cells regeneration factor,islet of langerhans regenerating protein,lithostathine 1 alpha,pancreatic stone protein, secretory,pancreatic thread protein,protein-X,regenerating islet-derived 1 alpha (pancreatic stone protein, pancrea
  • RSS
  • YouTube
  • Linkedin
  • Facebook