Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RDH5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005959-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RDH5 partial ORF ( AAH28298, 181 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGAFLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005959-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5959
  • Gene Name:
  • RDH5
  • Gene Alias:
  • FLJ39337,FLJ97089,HSD17B9,RDH1,SDR9C5
  • Gene Description:
  • retinol dehydrogenase 5 (11-cis/9-cis)
  • Gene Summary:
  • This gene encodes an enzyme belonging to the short-chain dehydrogenases/reductases (SDR) family. This retinol dehydrogenase functions to catalyze the final step in the biosynthesis of 11-cis retinaldehyde, which is the universal chromophore of visual pigments. Mutations in this gene cause autosomal recessive fundus albipunctatus, a rare form of night blindness that is characterized by a delay in the regeneration of cone and rod photopigments. [provided by RefSeq
  • Other Designations:
  • 11-cis RDH,9-cis-retinol specific dehydrogenase,retinol dehydrogenase 1,retinol dehydrogenase 5 (11-cis and 9-cis),short chain dehydrogenase/reductase family 9C, member 5
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook