Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RDH5 polyclonal antibody (A01)

  • Catalog # : H00005959-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RDH5.
  • Immunogen:
  • RDH5 (AAH28298, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGAFLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005959-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5959
  • Gene Name:
  • RDH5
  • Gene Alias:
  • FLJ39337,FLJ97089,HSD17B9,RDH1,SDR9C5
  • Gene Description:
  • retinol dehydrogenase 5 (11-cis/9-cis)
  • Gene Summary:
  • This gene encodes an enzyme belonging to the short-chain dehydrogenases/reductases (SDR) family. This retinol dehydrogenase functions to catalyze the final step in the biosynthesis of 11-cis retinaldehyde, which is the universal chromophore of visual pigments. Mutations in this gene cause autosomal recessive fundus albipunctatus, a rare form of night blindness that is characterized by a delay in the regeneration of cone and rod photopigments. [provided by RefSeq
  • Other Designations:
  • 11-cis RDH,9-cis-retinol specific dehydrogenase,retinol dehydrogenase 1,retinol dehydrogenase 5 (11-cis and 9-cis),short chain dehydrogenase/reductase family 9C, member 5
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook