RDH5 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RDH5.
Immunogen
RDH5 (AAH28298, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Sequence
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGAFLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — RDH5
Entrez GeneID
5959GeneBank Accession#
BC028298Protein Accession#
AAH28298Gene Name
RDH5
Gene Alias
FLJ39337, FLJ97089, HSD17B9, RDH1, SDR9C5
Gene Description
retinol dehydrogenase 5 (11-cis/9-cis)
Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme belonging to the short-chain dehydrogenases/reductases (SDR) family. This retinol dehydrogenase functions to catalyze the final step in the biosynthesis of 11-cis retinaldehyde, which is the universal chromophore of visual pigments. Mutations in this gene cause autosomal recessive fundus albipunctatus, a rare form of night blindness that is characterized by a delay in the regeneration of cone and rod photopigments. [provided by RefSeq
Other Designations
11-cis RDH|9-cis-retinol specific dehydrogenase|retinol dehydrogenase 1|retinol dehydrogenase 5 (11-cis and 9-cis)|short chain dehydrogenase/reductase family 9C, member 5
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.
Fokidis HB, Yieng Chin M, Ho VW, Adomat HH, Soma KK, Fazli L, Nip KM, Cox M, Krystal G, Zoubeidi A, Tomlinson Guns ES.
The Journal of Steroid Biochemistry and Molecular Biology 2015 Jun; 150:35.
Application：WB, Mouse, LNCaP tumor.
-
Insulin increases de novo steroidogenesis in prostate cancer cells.
Lubik AA, Gunter JH, Hendy SC, Locke JA, Adomat HH, Thompson V, Herington A, Gleave ME, Pollak M, Nelson CC.
Cancer Research 2014 Sep; 71(17):5754.
Application：WB-Ce, Human, LNCaP, 22RV1 cells.
-
Androgen Levels Increase by Intratumoral De novo Steroidogenesis during Progression of Castration-Resistant Prostate Cancer.
Locke JA, Guns ES, Lubik AA, Adomat HH, Hendy SC, Wood CA, Ettinger SL, Gleave ME, Nelson CC.
Cancer Research 2008 Aug; 68(15):6407.
Application：WB, Human, LNCaP xenograft tumors.
-
A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com