RBP4 monoclonal antibody (M01), clone 1E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RBP4.
Immunogen
RBP4 (AAH20633.1, 19 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RBP4 monoclonal antibody (M01), clone 1E9 Western Blot analysis of RBP4 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RBP4 expression in transfected 293T cell line by RBP4 monoclonal antibody (M01), clone 1E9.
Lane 1: RBP4 transfected lysate(23 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RBP4 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RBP4
Entrez GeneID
5950GeneBank Accession#
BC020633Protein Accession#
AAH20633.1Gene Name
RBP4
Gene Alias
-
Gene Description
retinol binding protein 4, plasma
Omim ID
180250Gene Ontology
HyperlinkGene Summary
This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq
Other Designations
OTTHUMP00000020114|OTTHUMP00000020116|retinol-binding protein 4, interstitial|retinol-binding protein 4, plasma
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com