Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBP2 (Human) Recombinant Protein (P01)

  • Catalog # : H00005948-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RBP2 full-length ORF ( NP_004155.2, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005948-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5948
  • Gene Name:
  • RBP2
  • Gene Alias:
  • CRABP-II,CRBP2,CRBPII,RBPC2
  • Gene Description:
  • retinol binding protein 2, cellular
  • Gene Summary:
  • RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq
  • Other Designations:
  • retinol-binding protein 2, cellular
  • RSS
  • YouTube
  • Linkedin
  • Facebook