RBM3 monoclonal antibody (M06), clone 4D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RBM3 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RBM3 on HeLa cell . [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (34.54 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RBM3.
Immunogen
RBM3 (NP_006734.1, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RBM3 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RBM3 on HeLa cell . [antibody concentration 40 ug/ml] -
Gene Info — RBM3
Entrez GeneID
5935GeneBank Accession#
NM_006743Protein Accession#
NP_006734.1Gene Name
RBM3
Gene Alias
IS1-RNPL, RNPL
Gene Description
RNA binding motif (RNP1, RRM) protein 3
Omim ID
300027Gene Ontology
HyperlinkGene Summary
This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq
Other Designations
OTTHUMP00000025800|OTTHUMP00000025802|RNA binding motif protein 3
-
Interactome
-
Publication Reference
-
Differential expression of the RNA-binding motif protein 3 in human astrocytoma.
Zhang HT, Zhang ZW, Xue JH, Kong HB, Liu AJ, Li SC, Liu YX, Xu DG.
Chinese Medical Journal 2013 May; 126(10):1948.
Application：IHC-P, Human, Astrocytoma, Brain.
-
Differential expression of the RNA-binding motif protein 3 in human astrocytoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com