RBBP7 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RBBP7 full-length ORF ( NP_002884.1, 1 a.a. - 425 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
74.2
Interspecies Antigen Sequence
Mouse (99); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RBBP7
Entrez GeneID
5931GeneBank Accession#
NM_002893.2Protein Accession#
NP_002884.1Gene Name
RBBP7
Gene Alias
MGC138867, MGC138868, RbAp46
Gene Description
retinoblastoma binding protein 7
Omim ID
602922Gene Ontology
HyperlinkGene Summary
This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. [provided by RefSeq
Other Designations
G1/S transition control protein-binding protein RbAp46|histone acetyltransferase type B subunit 2|retinoblastoma-binding protein 7|retinoblastoma-binding protein RbAp46|retinoblastoma-binding protein p46
-
Interactome
-
Disease
-
Publication Reference
-
A Bifunctional NAD + for Profiling Poly-ADP-Ribosylation-Dependent Interacting Proteins.
Albert T Lam, Xiao-Nan Zhang, Valentine V Courouble, Timothy S Strutzenberg, Hua Pei, Bangyan L Stiles, Stan G Louie, Patrick R Griffin, Yong Zhang.
ACS Chemical Biology 2021 Feb; 16(2):389.
Application：Func, PI, Recombinant proteins.
-
A Bifunctional NAD + for Profiling Poly-ADP-Ribosylation-Dependent Interacting Proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com