Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBBP6 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005930-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RBBP6 protein.
  • Immunogen:
  • RBBP6 (NP_116015.2, 1 a.a. ~ 118 a.a) full-length human protein.
  • Sequence:
  • MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RBBP6 expression in transfected 293T cell line (H00005930-T01) by RBBP6 MaxPab polyclonal antibody.

    Lane 1: RBBP6 transfected lysate(12.98 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5930
  • Gene Name:
  • RBBP6
  • Gene Alias:
  • DKFZp686P0638,DKFZp761B2423,MY038,P2P-R,PACT,RBQ-1,SNAMA
  • Gene Description:
  • retinoblastoma binding protein 6
  • Gene Summary:
  • The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • RB-binding Q-protein 1,proliferation potential-related protein,retinoblastoma-binding protein 6,retinoblastoma-binding protein 6, isoform 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook