JARID1A monoclonal antibody (M03), clone 1H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of JARID1A expression in transfected 293T cell line by JARID1A monoclonal antibody (M03), clone 1H2.
Lane 1: JARID1A transfected lysate (Predicted MW: 11.11 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged JARID1A is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant JARID1A.
Immunogen
JARID1A (NP_005047, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of JARID1A expression in transfected 293T cell line by JARID1A monoclonal antibody (M03), clone 1H2.
Lane 1: JARID1A transfected lysate (Predicted MW: 11.11 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged JARID1A is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — JARID1A
Entrez GeneID
5927GeneBank Accession#
NM_005056Protein Accession#
NP_005047Gene Name
JARID1A
Gene Alias
KDM5A, RBBP2, RBP2
Gene Description
jumonji, AT rich interactive domain 1A
Omim ID
180202Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
Jumonji, AT rich interactive domain 1A (RBBP2-like)|Jumonji, AT rich interactive domain 1A (RBP2-like)|retinoblastoma binding protein 2|retinoblastoma-binding protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com