Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

JARID1A polyclonal antibody (A01)

  • Catalog # : H00005927-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant JARID1A.
  • Immunogen:
  • JARID1A (NP_005047, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005927-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • JARID1A polyclonal antibody (A01), Lot # 051019JC01 Western Blot analysis of JARID1A expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5927
  • Gene Name:
  • JARID1A
  • Gene Alias:
  • KDM5A,RBBP2,RBP2
  • Gene Description:
  • jumonji, AT rich interactive domain 1A
  • Gene Summary:
  • The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Jumonji, AT rich interactive domain 1A (RBBP2-like),Jumonji, AT rich interactive domain 1A (RBP2-like),retinoblastoma binding protein 2,retinoblastoma-binding protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook