Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARID4A (Human) Recombinant Protein (Q01)

  • Catalog # : H00005926-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARID4A partial ORF ( NP_002883, 1033 a.a. - 1139 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005926-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5926
  • Gene Name:
  • ARID4A
  • Gene Alias:
  • RBBP1,RBP-1,RBP1
  • Gene Description:
  • AT rich interactive domain 4A (RBP1-like)
  • Gene Summary:
  • The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described. [provided by RefSeq
  • Other Designations:
  • retinoblastoma binding protein 1,retinoblastoma-binding protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook