Product Browser

Last updated: 2017/12/10
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RARRES3 polyclonal antibody (A01)

  • Catalog # : H00005920-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RARRES3.
  • Immunogen:
  • RARRES3 (NP_004576, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRGRLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005920-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5920
  • Gene Name:
  • RARRES3
  • Gene Alias:
  • HRASLS4,MGC8906,RIG1,TIG3
  • Gene Description:
  • retinoic acid receptor responder (tazarotene induced) 3
  • Gene Summary:
  • Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator. [provided by RefSeq
  • Other Designations:
  • retinoic acid-inducible gene 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook