RARRES1 monoclonal antibody (M06), clone 2E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RARRES1 monoclonal antibody (M06), clone 2E2. Western Blot analysis of RARRES1 expression in HL-60(Cat # L014V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RARRES1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RARRES1.
Immunogen
RARRES1 (NP_996846, 205 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RARRES1 monoclonal antibody (M06), clone 2E2. Western Blot analysis of RARRES1 expression in HL-60(Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RARRES1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — RARRES1
Entrez GeneID
5918GeneBank Accession#
NM_206963Protein Accession#
NP_996846Gene Name
RARRES1
Gene Alias
TIG1
Gene Description
retinoic acid receptor responder (tazarotene induced) 1
Omim ID
605090Gene Ontology
HyperlinkGene Summary
This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
RAR-responsive protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com