RARRES1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RARRES1 expression in transfected 293T cell line (H00005918-T01) by RARRES1 MaxPab polyclonal antibody.
Lane 1: RARRES1 transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RARRES1 protein.
Immunogen
RARRES1 (NP_996846.1, 1 a.a. ~ 294 a.a) full-length human protein.
Sequence
MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RARRES1 expression in transfected 293T cell line (H00005918-T01) by RARRES1 MaxPab polyclonal antibody.
Lane 1: RARRES1 transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RARRES1
Entrez GeneID
5918GeneBank Accession#
NM_206963.1Protein Accession#
NP_996846.1Gene Name
RARRES1
Gene Alias
TIG1
Gene Description
retinoic acid receptor responder (tazarotene induced) 1
Omim ID
605090Gene Ontology
HyperlinkGene Summary
This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
RAR-responsive protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com