RARB (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RARB full-length ORF ( NP_000956.2, 1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
76.7
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RARB
Entrez GeneID
5915GeneBank Accession#
NM_000965.2Protein Accession#
NP_000956.2Gene Name
RARB
Gene Alias
HAP, NR1B2, RRB2
Gene Description
retinoic acid receptor, beta
Omim ID
180220Gene Ontology
HyperlinkGene Summary
This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined. [provided by RefSeq
Other Designations
HBV-activated protein|RAR-epsilon|hepatitis B virus activated protein|retinoic acid receptor beta 2|retinoic acid receptor beta 4|retinoic acid receptor beta 5|retinoic acid receptor, beta polypeptide
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Leucine-rich repeat kinase 2 modulates retinoic Acid-induced neuronal differentiation of murine embryonic stem cells.
Schulz C, Paus M, Frey K, Schmid R, Kohl Z, Mennerich D, Winkler J, Gillardon F.
PLoS One 2011 Jun; 6(6):e20820.
Application:KA, Recombinant protein.
-
Leucine-rich repeat kinase 2 modulates retinoic Acid-induced neuronal differentiation of murine embryonic stem cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com