RARA (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RARA full-length ORF ( AAH08727, 1 a.a. - 462 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
76.56
Interspecies Antigen Sequence
Mouse (98); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RARA
Entrez GeneID
5914GeneBank Accession#
BC008727Protein Accession#
AAH08727Gene Name
RARA
Gene Alias
NR1B1, RAR
Gene Description
retinoic acid receptor, alpha
Omim ID
180240Gene Ontology
HyperlinkGene Summary
Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor (RXR; see MIM 180245), which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1 (MIM 600849), SMRT (NCOR2; MIM 600848), and histone deacetylase (see MIM 601241). When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases (see MIM 603053), and the basic transcription machinery. Translocations that always involve rearrangement of the RARA gene are a cardinal feature of acute promyelocytic leukemia (APL; MIM 612376). The most frequent translocation is t(15,17)(q21;q22), which fuses the RARA gene with the PML gene (MIM 102578) (Vitoux et al., 2007 [PubMed 17468032]).[supplied by OMIM
Other Designations
OTTHUMP00000164454|OTTHUMP00000164456|Retinoic acid receptor, alpha polypeptide|nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Non-Genomic Activities of Retinoic Acid Receptor Alpha Control Actin Cytoskeletal Events in Human Platelets.
Rondina MT, Freitag M, Pluthero FG, Kahr WH, Rowley JW, Kraiss LW, Franks Z, Zimmerman GA, Weyrich AS, Schwertz H.
Journal of Thrombosis and Haemostasis 2016 May; 14(5):1082.
Application:Actin Branching Assay, Human, Purified Protein.
-
Leucine-rich repeat kinase 2 modulates retinoic Acid-induced neuronal differentiation of murine embryonic stem cells.
Schulz C, Paus M, Frey K, Schmid R, Kohl Z, Mennerich D, Winkler J, Gillardon F.
PLoS One 2011 Jun; 6(6):e20820.
Application:KA, Recombinant protein.
-
Non-Genomic Activities of Retinoic Acid Receptor Alpha Control Actin Cytoskeletal Events in Human Platelets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com