RARA monoclonal antibody (M01), clone 2C9-1F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RARA monoclonal antibody (M01), clone 2C9-1F8 Western Blot analysis of RARA expression in A-431 ( Cat # L015V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to RARA on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (76.56 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RARA.
Immunogen
RARA (AAH08727, 1 a.a. ~ 462 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (96)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (76.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RARA monoclonal antibody (M01), clone 2C9-1F8 Western Blot analysis of RARA expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RARA on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 5 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RARA on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — RARA
Entrez GeneID
5914GeneBank Accession#
BC008727Protein Accession#
AAH08727Gene Name
RARA
Gene Alias
NR1B1, RAR
Gene Description
retinoic acid receptor, alpha
Omim ID
180240Gene Ontology
HyperlinkGene Summary
Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor (RXR; see MIM 180245), which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1 (MIM 600849), SMRT (NCOR2; MIM 600848), and histone deacetylase (see MIM 601241). When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases (see MIM 603053), and the basic transcription machinery. Translocations that always involve rearrangement of the RARA gene are a cardinal feature of acute promyelocytic leukemia (APL; MIM 612376). The most frequent translocation is t(15,17)(q21;q22), which fuses the RARA gene with the PML gene (MIM 102578) (Vitoux et al., 2007 [PubMed 17468032]).[supplied by OMIM
Other Designations
OTTHUMP00000164454|OTTHUMP00000164456|Retinoic acid receptor, alpha polypeptide|nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Profound gene expression changes in the epithelial monolayer of active ulcerative colitis and Crohn's disease.
Siri Sæterstad, Ann Elisabet Østvik, Elin Synnøve Røyset, Ingunn Bakke, Arne Kristian Sandvik, Atle van Beelen GranlundID.
PLoS One 2022 Mar; 17(3):e0265189.
Application：IHC, Human, Epithelial cells.
-
Profound gene expression changes in the epithelial monolayer of active ulcerative colitis and Crohn's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com