Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAPSN (Human) Recombinant Protein (Q01)

  • Catalog # : H00005913-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAPSN partial ORF ( NP_005046, 313 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005913-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5913
  • Gene Name:
  • RAPSN
  • Gene Alias:
  • CMS1D,CMS1E,MGC3597,RNF205
  • Gene Description:
  • receptor-associated protein of the synapse
  • Gene Summary:
  • This protein belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Two splice variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • 43 kD receptor-associated protein of the synapse,43 kda postsynaptic protein,acetylcholine receptor-associated 43 kda protein,rapsyn,receptor-associated protein of the synapse, 43kD
  • RSS
  • YouTube
  • Linkedin
  • Facebook