RAP2B monoclonal antibody (M01), clone 4F12-3C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAP2B monoclonal antibody (M01), clone 4F12-3C6 Western Blot analysis of RAP2B expression in A-431 ( Cat # L015V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RAP2B on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to RAP2B on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (45.87 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RAP2B.
Immunogen
RAP2B (AAH12362, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAP2B monoclonal antibody (M01), clone 4F12-3C6 Western Blot analysis of RAP2B expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RAP2B on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RAP2B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RAP2B
Entrez GeneID
5912GeneBank Accession#
BC012362Protein Accession#
AAH12362Gene Name
RAP2B
Gene Alias
MGC20484
Gene Description
RAP2B, member of RAS oncogene family
Omim ID
179541Gene Ontology
HyperlinkGene Summary
This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. [provided by RefSeq
Other Designations
Ras family small GTP binding protein RAP2B|Ras-related protein RAP-2B|small GTP binding protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com