Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAP2A polyclonal antibody (A01)

  • Catalog # : H00005911-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant RAP2A.
  • Immunogen:
  • RAP2A (AAH41333, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005911-A01
    Western Blot detection against Immunogen (46.24 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RAP2A expression in transfected 293T cell line by RAP2A polyclonal antibody (A01).

    Lane1:RAP2A transfected lysate(20.6 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5911
  • Gene Name:
  • RAP2A
  • Gene Alias:
  • K-REV,KREV,RAP2,RbBP-30
  • Gene Description:
  • RAP2A, member of RAS oncogene family
  • Other Designations:
  • OTTHUMP00000018581,RAP2, member of RAS oncogene family (K-rev)
  • RSS
  • YouTube
  • Linkedin
  • Facebook