RALB monoclonal antibody (M04), clone 4D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RALB.
Immunogen
RALB (AAH18163, 89 a.a. ~ 183 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RALB expression in transfected 293T cell line by RALB monoclonal antibody (M04), clone 4D1.
Lane 1: RALB transfected lysate(23.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RALB on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of RALB transfected lysate using anti-RALB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RALB MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RALB is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — RALB
Entrez GeneID
5899GeneBank Accession#
BC018163Protein Accession#
AAH18163Gene Name
RALB
Gene Alias
-
Gene Description
v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
Omim ID
179551Gene Ontology
HyperlinkGene Summary
This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq
Other Designations
GTP binding protein|RAS-like protein B|v-ral simian leukemia viral oncogene homolog B
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The mycobacterium bovis BCG phagosome proteome.
Lee BY, Jethwaney D, Schilling B, Clemens DL, Gibson BW, Horwitz MA.
Molecular & Cellular Proteomics 2010 Jan; 9(1):32.
Application:WB-Ce, Human, THP-1 cells.
-
The mycobacterium bovis BCG phagosome proteome.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com