Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RALB purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00005899-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human RALB protein.
  • Immunogen:
  • RALB (NP_002872.1, 1 a.a. ~ 206 a.a) full-length human protein.
  • Sequence:
  • MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RALB MaxPab rabbit polyclonal antibody. Western Blot analysis of RALB expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RALB MaxPab rabbit polyclonal antibody. Western Blot analysis of RALB expression in mouse lung.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RALB expression in transfected 293T cell line (H00005899-T01) by RALB MaxPab polyclonal antibody.

    Lane 1: RALB transfected lysate(23.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5899
  • Gene Name:
  • RALB
  • Gene Alias:
  • -
  • Gene Description:
  • v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
  • Gene Summary:
  • This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq
  • Other Designations:
  • GTP binding protein,RAS-like protein B,v-ral simian leukemia viral oncogene homolog B
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook