Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RALA (Human) Recombinant Protein (P01)

  • Catalog # : H00005898-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RALA full-length ORF ( AAH39858.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005898-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5898
  • Gene Name:
  • RALA
  • Gene Alias:
  • MGC48949,RAL
  • Gene Description:
  • v-ral simian leukemia viral oncogene homolog A (ras related)
  • Gene Summary:
  • The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq
  • Other Designations:
  • RAS-like protein A,Ras family small GTP binding protein RALA,Ras-related protein Ral-A,ras related v-ral simian leukemia viral oncogene homolog A
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook