RAD51C monoclonal antibody (M01), clone 3F3-5C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAD51C monoclonal antibody (M01), clone 3F3-5C6. Western Blot analysis of RAD51C expression in 293 ( Cat # L026V1 ).
Western Blot (Cell lysate)
RAD51C monoclonal antibody (M01), clone 3F3-5C6 Western Blot analysis of RAD51C expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RAD51C expression in transfected 293T cell line by RAD51C monoclonal antibody (M01), clone 3F3-5C6.
Lane 1: RAD51C transfected lysate(42.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAD51C is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of RAD51C over-expressed 293 cell line, cotransfected with RAD51C Validated Chimera RNAi ( Cat # H00005889-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD51C monoclonal antibody (M01), clone 3F3-5C6 (Cat # H00005889-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (40.48 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RAD51C.
Immunogen
RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (88)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.48 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAD51C monoclonal antibody (M01), clone 3F3-5C6. Western Blot analysis of RAD51C expression in 293 ( Cat # L026V1 ).Western Blot (Cell lysate)
RAD51C monoclonal antibody (M01), clone 3F3-5C6 Western Blot analysis of RAD51C expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAD51C expression in transfected 293T cell line by RAD51C monoclonal antibody (M01), clone 3F3-5C6.
Lane 1: RAD51C transfected lysate(42.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAD51C is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAD51C over-expressed 293 cell line, cotransfected with RAD51C Validated Chimera RNAi ( Cat # H00005889-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD51C monoclonal antibody (M01), clone 3F3-5C6 (Cat # H00005889-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RAD51C
Entrez GeneID
5889GeneBank Accession#
BC000667Protein Accession#
AAH00667.1Gene Name
RAD51C
Gene Alias
MGC104277, RAD51L2
Gene Description
RAD51 homolog C (S. cerevisiae)
Omim ID
602774Gene Ontology
HyperlinkGene Summary
This gene is a member of the RAD51 family of related genes, which encode strand-transfer proteins thought to be involved in recombinational repair of damaged DNA and in meiotic recombination. This gene product interacts with two other DNA repair proteins, encoded by RAD51B and XRCC3, but not with itself. The protein copurifies with XRCC3 protein in a complex, reflecting their endogenous association and suggesting a cooperative role during recombinational repair. This gene is one of four localized to a region of chromosome 17q23 where amplification occurs frequently in breast tumors. Overexpression of the four genes during amplification has been observed and suggests a possible role in tumor progression. Alternative splicing has been observed for this gene and two variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
DNA repair protein RAD51 homolog 3|RAD51 homolog C|RAD51 homolog C, isoform 1|yeast RAD51 homolog 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
RAD51C-XRCC3 structure and cancer patient mutations define DNA replication roles.
Michael A Longo, Sunetra Roy, Yue Chen, Karl-Heinz Tomaszowski, Andrew S Arvai, Jordan T Pepper, Rebecca A Boisvert, Selvi Kunnimalaiyaan, Caezanne Keshvani, David Schild, Albino Bacolla, Gareth J Williams, John A Tainer, Katharina Schlacher.
Nature Communications 2023 Jul; 14(1):4445.
Application：PLA, Human, HAP1 cell.
-
RAD51C-XRCC3 structure and cancer patient mutations define DNA replication roles.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com