RAD23B (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RAD23B partial ORF ( NP_002865.1, 311 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RAD23B
Entrez GeneID
5887GeneBank Accession#
NM_002874Protein Accession#
NP_002865.1Gene Name
RAD23B
Gene Alias
HHR23B, HR23B, P58
Gene Description
RAD23 homolog B (S. cerevisiae)
Omim ID
600062Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. [provided by RefSeq
Other Designations
OTTHUMP00000021857|RAD23, yeast homolog of, B|UV excision repair protein RAD23 homolog B|XP-C repair complementing complex 58 kDa|XP-C repair complementing protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Proteomic Identification of Hsp70 as a new Plk1 Substrate in Arsenic Trioxide-Induced Mitotically Arrested Cells.
Chen Y, Lin YP, Chow LP, Lee TC.
Proteomics 2011 Nov; 11(22):4331.
Application:KA, WB-Re, Recombinant proteins.
-
Proteomic Identification of Hsp70 as a new Plk1 Substrate in Arsenic Trioxide-Induced Mitotically Arrested Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com