RAD23A monoclonal antibody (M01), clone 3C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAD23A is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of RAD23A over-expressed 293 cell line, cotransfected with RAD23A Validated Chimera RNAi ( Cat # H00005886-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD23A monoclonal antibody (M01), clone 3C12 (Cat # H00005886-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAD23A.
Immunogen
RAD23A (AAH14026, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAD23A is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAD23A over-expressed 293 cell line, cotransfected with RAD23A Validated Chimera RNAi ( Cat # H00005886-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD23A monoclonal antibody (M01), clone 3C12 (Cat # H00005886-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RAD23A
Entrez GeneID
5886GeneBank Accession#
BC014026Protein Accession#
AAH14026Gene Name
RAD23A
Gene Alias
HHR23A, MGC111083
Gene Description
RAD23 homolog A (S. cerevisiae)
Omim ID
600061Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. [provided by RefSeq
Other Designations
RAD23, yeast homolog, A|UV excision repair protein RAD23 homolog A
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
DNA repair proteins as the targets for paroxetine to induce cytotoxicity in gastric cancer cell AGS.
Bang-Hung Liu, Tein-Ming Yuan, Chih-Jou Huang, Duan-Ting Hsu, Shi-Wen Chen, Nai-Wan Hsiao, Sheng-Chih Lin, Shu-Wan Wu, Yi-Mei J Lin and Show-Mei Chuang.
American Journal of Cancer Research 2022 Apr; 12(4):1465.
Application：WB-Ce, Human, AGS cells, MKN-45 cells.
-
Human Rad23A plays a regulatory role in autophagy.
Tan X, Wang HC, Liang RY, Chuang SM.
Biochemical and Biophysical Research Communications 2016 Sep; 478(4):1772.
Application：WB-Tr, Human, A549 cells.
-
hHR23A is required to control the basal turnover of Chk1.
Tana X, Lianga RY,Chuang SM.
Cellular Signalling 2015 Nov; 27(11):2304.
Application：WB, Human, A549 cells.
-
Cisplatin transiently up-regulates hHR23 expression through enhanced translational efficiency in A549 adenocarcinoma cells.
Shen YH, Chen BR, Cherng SH, Chueh PJ, Tan X, Lin YW, Lin JC, Chuang SM.
Toxicology Letters 2011 Sep; 205(3):341.
Application：WB-Ce, WB-Tr, Human, A549, HeLa cells.
-
DNA repair proteins as the targets for paroxetine to induce cytotoxicity in gastric cancer cell AGS.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com