RAC1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RAC1 full-length ORF ( AAH04247, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
46.86
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RAC1
Entrez GeneID
5879GeneBank Accession#
BC004247Protein Accession#
AAH04247Gene Name
RAC1
Gene Alias
MGC111543, MIG5, TC-25, p21-Rac1
Gene Description
ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Omim ID
602048Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
migration-inducing gene 5|migration-inducing protein 5|ras-related C3 botulinum toxin substrate 1|ras-related C3 botulinum toxin substrate 1 isoform Rac1|ras-related C3 botulinum toxin substrate 1 isoform Rac1b|rho family, small GTP binding protein Rac1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com