Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAC1 (Human) Recombinant Protein (P01)

  • Catalog # : H00005879-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAC1 full-length ORF ( AAH04247, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 46.86
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005879-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5879
  • Gene Name:
  • RAC1
  • Gene Alias:
  • MGC111543,MIG5,TC-25,p21-Rac1
  • Gene Description:
  • ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  • Gene Summary:
  • The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • migration-inducing gene 5,migration-inducing protein 5,ras-related C3 botulinum toxin substrate 1,ras-related C3 botulinum toxin substrate 1 isoform Rac1,ras-related C3 botulinum toxin substrate 1 isoform Rac1b,rho family, small GTP binding protein Rac1
  • RSS
  • YouTube
  • Linkedin
  • Facebook