RAB3B monoclonal antibody (M01), clone 3F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB3B.
Immunogen
RAB3B (AAH05035, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB3B monoclonal antibody (M01), clone 3F12. Western Blot analysis of RAB3B expression in IMR-32 ( Cat # L008V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M01), clone 3F12.
Lane 1: RAB3B transfected lysate(24.758 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RAB3B on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB3B is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RAB3B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RAB3B
-
Interactome
-
Pathway
-
Publication Reference
-
Gut-derived endotoxin stimulates factor viii secretion from endothelial cells. implications for hypercoagulability in cirrhosis.
Roberto C, Valeria R, Cristina N, Simona B, Marta N, Anna S, Elena F, Vittoria C, Chiara P, Clara C, Antonio SS, Oliviero R, Stefania B, Francesco V.
Journal of Hepatology 2017 Nov; 67(5):950.
Application:WB, Human, HUVEC .
-
Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
Vogel GF, Klee KM, Janecke AR, Muller T, Hess MW, Huber LA.
Journal of Cell Biology 2015 Nov; 211(3):587.
Application:WB, Human, CaCo2 WT, KI cells.
-
Gut-derived endotoxin stimulates factor viii secretion from endothelial cells. implications for hypercoagulability in cirrhosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com