RGL2 monoclonal antibody (M02), clone 4D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RGL2.
Immunogen
RGL2 (AAH32681, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG1
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RGL2 monoclonal antibody (M02), clone 4D10 Western Blot analysis of RGL2 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RGL2 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RGL2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RGL2
Entrez GeneID
5863GeneBank Accession#
BC032681Protein Accession#
AAH32681Gene Name
RGL2
Gene Alias
HKE1.5, KE1.5, RAB2L
Gene Description
ral guanine nucleotide dissociation stimulator-like 2
Omim ID
602306Gene Ontology
HyperlinkGene Summary
member RAS oncogene family-like
Other Designations
GDS-related protein|OTTHUMP00000029085|RAB2, member RAS oncogene family-like
-
Interactome
-
Disease
-
Publication Reference
-
M-Ras induces Ral and JNK activation to regulate MEK/ERK-independent gene expression in MCF-7 breast cancer cells.
Castro AF, Campos T, Babcock JT, Armijo ME, Martinez-Conde A, Pincheira R, Quilliam LA.
Journal of Cellular Biochemistry 2012 Apr; 113(4):1253.
Application:WB-Tr, Human, HeLa cells.
-
Aberrant overexpression of the Rgl2 Ral small GTPase-specific guanine nucleotide exchange factor promotes pancreatic cancer growth through Ral-dependent and Ral-independent mechanisms.
Vigil D, Martin TD, Williams F, Yeh JJ, Campbell SL, Der CJ.
The Journal of Biological Chemistry 2010 Aug; 285(45):34729.
Application:WB, Human, Human pancreatic ductal adenocarcinoma tissues, and BxPC-3, Capan-1, Capan-2, HPAC, HPAF-II, Hs7767, HuP-T3, MIA PaCa-2, PANC-1, Panc 03.27, Panc 02.13, Panc 10.05, Panc 02.03, SW-1990, T3M4 cells.
-
M-Ras induces Ral and JNK activation to regulate MEK/ERK-independent gene expression in MCF-7 breast cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com