Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAB1A (Human) Recombinant Protein (P01)

  • Catalog # : H00005861-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAB1A full-length ORF ( AAH00905, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.29
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005861-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5861
  • Gene Name:
  • RAB1A
  • Gene Alias:
  • DKFZp564B163,RAB1,YPT1
  • Gene Description:
  • RAB1A, member RAS oncogene family
  • Gene Summary:
  • This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. [provided by RefSeq
  • Other Designations:
  • GTP binding protein Rab1a,RAB1, member RAS oncogene family,Rab GTPase YPT1 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook