QDPR monoclonal antibody (M02), clone M1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant QDPR.
Immunogen
QDPR (AAH00576, 1 a.a. ~ 244 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.58 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
QDPR monoclonal antibody (M02), clone M1 Western Blot analysis of QDPR expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of QDPR expression in transfected 293T cell line by QDPR monoclonal antibody (M02), clone M1.
Lane 1: QDPR transfected lysate(25.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged QDPR is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of QDPR over-expressed 293 cell line, cotransfected with QDPR Validated Chimera RNAi ( Cat # H00005860-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with QDPR monoclonal antibody (M02), clone M1 (Cat # H00005860-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — QDPR
Entrez GeneID
5860GeneBank Accession#
BC000576Protein Accession#
AAH00576Gene Name
QDPR
Gene Alias
DHPR, FLJ42391, PKU2, SDR33C1
Gene Description
quinoid dihydropteridine reductase
Omim ID
261630Gene Ontology
HyperlinkGene Summary
This gene encodes the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin. This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems. Mutations in this gene resulting in QDPR deficiency include aberrant splicing, amino acid substitutions, insertions, or premature terminations. Dihydropteridine reductase deficiency presents as atypical phenylketonuria due to insufficient production of biopterin, a cofactor for phenylalanine hydroxylase. [provided by RefSeq
Other Designations
6,7-dihydropteridine reductase|short chain dehydrogenase/reductase family 33C, member 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Human myelin proteome and comparative analysis with mouse myelin.
Ishii A, Dutta R, Wark GM, Hwang SI, Han DK, Trapp BD, Pfeiffer SE, Bansal R.
PNAS 2009 Aug; 106(34):14605.
Application:WB-Ti, Human, Human brain tissues, Human myelins.
-
Human myelin proteome and comparative analysis with mouse myelin.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com