Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

QARS monoclonal antibody (M01), clone 5F5

  • Catalog # : H00005859-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant QARS.
  • Immunogen:
  • QARS (NP_005042, 677 a.a. ~ 775 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005859-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • QARS monoclonal antibody (M01), clone 5F5 Western Blot analysis of QARS expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of QARS expression in transfected 293T cell line by QARS monoclonal antibody (M01), clone 5F5.

    Lane 1: QARS transfected lysate(87.8 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of QARS transfected lysate using anti-QARS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with QARS MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged QARS is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5859
  • Gene Name:
  • QARS
  • Gene Alias:
  • GLNRS,PRO2195
  • Gene Description:
  • glutaminyl-tRNA synthetase
  • Gene Summary:
  • Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family. [provided by RefSeq
  • Other Designations:
  • glutamine tRNA ligase,glutamine-tRNA synthetase
  • RSS
  • YouTube
  • Linkedin
  • Facebook