Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PVRL1 polyclonal antibody (A01)

  • Catalog # : H00005818-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PVRL1.
  • Immunogen:
  • PVRL1 (NP_002846, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PVRL1 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of PVRL1 expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5818
  • Gene Name:
  • PVRL1
  • Gene Alias:
  • CD111,CLPED1,ED4,HIgR,HVEC,MGC142031,MGC16207,OFC7,PRR,PRR1,PVRR,PVRR1,SK-12,nectin-1
  • Gene Description:
  • poliovirus receptor-related 1 (herpesvirus entry mediator C)
  • Other Designations:
  • ectodermal dysplasia 4 (Margarita Island type),herpesvirus entry mediator C,nectin 1,poliovirus receptor related,poliovirus receptor-like 1,poliovirus receptor-related 1,poliovirus receptor-related 1 (herpesvirus entry mediator C; nectin)
  • RSS
  • YouTube
  • Linkedin
  • Facebook