Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PURA polyclonal antibody (A01)

  • Catalog # : H00005813-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PURA.
  • Immunogen:
  • PURA (NP_005850, 183 a.a. ~ 292 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005813-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PURA polyclonal antibody (A01), Lot # OHS1060112QC01. Western Blot analysis of PURA expression in human uterus myoma.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PURA polyclonal antibody (A01), Lot # ABNOVA060627QCS1. Western Blot analysis of PURA expression in human fetal heart.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5813
  • Gene Name:
  • PURA
  • Gene Alias:
  • PUR-ALPHA,PUR1,PURALPHA
  • Gene Description:
  • purine-rich element binding protein A
  • Gene Summary:
  • This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia. [provided by RefSeq
  • Other Designations:
  • purine-rich single-stranded DNA-binding protein alpha,transcriptional activator protein PUR-alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook