PTPRN monoclonal antibody (M07), clone 8E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PTPRN expression in transfected 293T cell line by PTPRN monoclonal antibody (M07), clone 8E3.
Lane 1: PTPRN transfected lysate (Predicted MW: 65.01 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTPRN is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.4 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PTPRN.
Immunogen
PTPRN (NP_002837, 205 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PTPRN expression in transfected 293T cell line by PTPRN monoclonal antibody (M07), clone 8E3.
Lane 1: PTPRN transfected lysate (Predicted MW: 65.01 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTPRN is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PTPRN
Entrez GeneID
5798GeneBank Accession#
NM_002846Protein Accession#
NP_002837Gene Name
PTPRN
Gene Alias
FLJ16131, IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N
Gene Description
protein tyrosine phosphatase, receptor type, N
Omim ID
601773Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. [provided by RefSeq
Other Designations
islet cell antigen 2|islet cell antigen 512|islet cell autoantigen 3|protein tyrosine phosphatase-like N
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com