PTPRK (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PTPRK full-length ORF (ADR82748.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAVSVLVVGNFCCCCSAAVCHSIRHLSRTQNPGQDHEGRLKRWLYF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
8.5
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — PTPRK
Entrez GeneID
5796GeneBank Accession#
HQ257994.1Protein Accession#
ADR82748.1Gene Name
PTPRK
Gene Alias
DKFZp686C2268, DKFZp779N1045, R-PTP-kappa
Gene Description
protein tyrosine phosphatase, receptor type, K
Omim ID
602545Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP mu (MAM) domain, an Ig-like domain and four fibronectin type III-like repeats. This PTP was shown to mediate homophilic intercellular interaction, possibly through the interaction with beta- and gamma-catenin at adherens junctions. Expression of this gene was found to be stimulated by TGF-beta 1, which may be important for the inhibition of keratinocyte proliferation. [provided by RefSeq
Other Designations
OTTHUMP00000017180|OTTHUMP00000040306|dJ480J14.2.1 (protein tyrosine phosphatase, receptor type, K (R-PTP-KAPPA, protein tyrosine phosphatase kappa , protein tyrosine phosphatase kappa|protein-tyrosine phosphatase kappa|protein-tyrosine phosphatase, recep
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com