Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTPRK (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00005796-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTPRK full-length ORF (ADR82748.1) recombinant protein without tag.
  • Sequence:
  • MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAVSVLVVGNFCCCCSAAVCHSIRHLSRTQNPGQDHEGRLKRWLYF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 8.5
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 5796
  • Gene Name:
  • PTPRK
  • Gene Alias:
  • DKFZp686C2268,DKFZp779N1045,R-PTP-kappa
  • Gene Description:
  • protein tyrosine phosphatase, receptor type, K
  • Gene Summary:
  • The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP mu (MAM) domain, an Ig-like domain and four fibronectin type III-like repeats. This PTP was shown to mediate homophilic intercellular interaction, possibly through the interaction with beta- and gamma-catenin at adherens junctions. Expression of this gene was found to be stimulated by TGF-beta 1, which may be important for the inhibition of keratinocyte proliferation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017180,OTTHUMP00000040306,dJ480J14.2.1 (protein tyrosine phosphatase, receptor type, K (R-PTP-KAPPA, protein tyrosine phosphatase kappa , protein tyrosine phosphatase kappa,protein-tyrosine phosphatase kappa,protein-tyrosine phosphatase, recep
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook