Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTPRG (Human) Recombinant Protein (P01)

  • Catalog # : H00005793-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTPRG full-length ORF ( AAH47734.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSGKSSCSNGDHTGQLTSHSTHLKAHFESLLCLSSVCSNLS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005793-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5793
  • Gene Name:
  • PTPRG
  • Gene Alias:
  • HPTPG,PTPG,R-PTP-GAMMA,RPTPG
  • Gene Description:
  • protein tyrosine phosphatase, receptor type, G
  • Gene Summary:
  • The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this PTP contains a carbonic anhydrase-like (CAH) domain, which is also found in the extracellular region of PTPRBETA/ZETA. This gene is located in a chromosomal region that is frequently deleted in renal cell carcinoma and lung carcinoma, thus is thought to be a candidate tumor suppressor gene. [provided by RefSeq
  • Other Designations:
  • H_RG317H01.1,protein tyrosine phosphatase gamma,protein tyrosine phosphatase, receptor type, gamma polypeptide,receptor type protein tyrosine phosphatase gamma,receptor tyrosine phosphatase gamma,receptor-type protein phosphatase gamma
  • RSS
  • YouTube
  • Linkedin
  • Facebook