PTPN1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human PTPN1 protein.
Immunogen
PTPN1 (NP_002818.1, 1 a.a. ~ 435 a.a) full-length human protein.
Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PTPN1 MaxPab polyclonal antibody. Western Blot analysis of PTPN1 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of PTPN1 expression in transfected 293T cell line (H00005770-T01) by PTPN1 MaxPab polyclonal antibody.
Lane 1: PTPN1 transfected lysate(47.85 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PTPN1
Entrez GeneID
5770GeneBank Accession#
NM_002827.2Protein Accession#
NP_002818.1Gene Name
PTPN1
Gene Alias
PTP1B
Gene Description
protein tyrosine phosphatase, non-receptor type 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. [provided by RefSeq
Other Designations
OTTHUMP00000031266|non-receptor tyrosine phosphatase 1|protein tyrosine phosphatase 1B|protein tyrosine phosphatase, placental
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com