Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTHR1 polyclonal antibody (A02)

  • Catalog # : H00005745-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PTHR1.
  • Immunogen:
  • PTHR1 (NP_000307, 27 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005745-A02
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PTHR1 polyclonal antibody (A02), Lot # 060807QCS1. Western Blot analysis of PTHR1 expression in HeLa.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PTHR1 polyclonal antibody (A02), Lot # 051207JC01 Western Blot analysis of PTHR1 expression in MCF-7 ( Cat # L046V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5745
  • Gene Name:
  • PTH1R
  • Gene Alias:
  • MGC138426,MGC138452,PTHR,PTHR1
  • Gene Description:
  • parathyroid hormone 1 receptor
  • Gene Summary:
  • The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in this receptor are known to be the cause of Jansen's metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), as well as enchodromatosis. [provided by RefSeq
  • Other Designations:
  • PTH/PTHr receptor,PTH/PTHrP type I receptor,parathyroid hormone receptor 1,parathyroid hormone/parathyroid hormone-related peptide receptor,parathyroid hormone/parathyroid hormone-related protein receptor,seven transmembrane helix receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook