Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTHLH (Human) Recombinant Protein (P01)

  • Catalog # : H00005744-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTHLH full-length ORF ( AAH05961, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.99
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005744-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5744
  • Gene Name:
  • PTHLH
  • Gene Alias:
  • HHM,MGC14611,PLP,PTHR,PTHRP
  • Gene Description:
  • parathyroid hormone-like hormone
  • Gene Summary:
  • The protein encoded by this gene is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, in-frame and downstream of the initiator AUG codon, to give rise to nuclear forms of this hormone. [provided by RefSeq
  • Other Designations:
  • PTH-related protein,humoral hypercalcemia of malignancy,osteostatin,parathyroid hormone-like protein,parathyroid hormone-like related protein,parathyroid hormone-related protein,parathyroid-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook