PTGIS polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PTGIS.
Immunogen
PTGIS (NP_000952, 391 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Sequence
PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
Host
Mouse
Reactivity
Human, Mouse
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PTGIS polyclonal antibody (A01), Lot # 050921JC01 Western Blot analysis of PTGIS expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PTGIS
Entrez GeneID
5740GeneBank Accession#
NM_000961Protein Accession#
NP_000952Gene Name
PTGIS
Gene Alias
CYP8, CYP8A1, MGC126858, MGC126860, PGIS, PTGI
Gene Description
prostaglandin I2 (prostacyclin) synthase
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. [provided by RefSeq
Other Designations
OTTHUMP00000031777|cytochrome P450, family 8, subfamily A, polypeptide 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Reduced prostaglandin I2 signaling in Arid5b-/- primary skeletal muscle cells attenuates myogenesis.
Murray J, Whitson RH, Itakura K.
FASEB Journal 2018 Apr; 32(4):1868.
Application:WB, Mouse, Mouse primary skeletal muscle satellite cells.
-
Mechanism of prostacyclin-induced potentiation of glucose-induced insulin secretion.
Gurgul-Convey E, Hanzelka K, Lenzen S.
Endocrinology 2012 Jun; 153(6):2612.
Application:IF, WB, Rat, INS1E cells, Rat islet cells, Rat islets.
-
Reduced prostaglandin I2 signaling in Arid5b-/- primary skeletal muscle cells attenuates myogenesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com