Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTEN (Human) Recombinant Protein (Q02)

  • Catalog # : H00005728-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTEN partial ORF (NP_000305.1, 2 a.a. - 91 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFE
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00005728-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5728
  • Gene Name:
  • PTEN
  • Gene Alias:
  • 10q23del,BZS,MGC11227,MHAM,MMAC1,PTEN1,TEP1
  • Gene Description:
  • phosphatase and tensin homolog
  • Gene Summary:
  • This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. [provided by RefSeq
  • Other Designations:
  • MMAC1 phosphatase and tensin homolog deleted on chromosome 10,OTTHUMP00000020032,mutated in multiple advanced cancers 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook